PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0006s0363.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family HB-other
Protein Properties Length: 658aa    MW: 73467.1 Da    PI: 4.6268
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0006s0363.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.11.3e-076006322254
                           SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
              Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            +yp++ee+e L +++gL+ +qV +WF N+R +
  Sphfalx0006s0363.1.p 600 WPYPTEEEKEGLIQETGLELKQVNNWFINQRKR 632
                           58*****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.3E-10375418IPR005540KNOX1
PfamPF037901.9E-11377413IPR005540KNOX1
SMARTSM012562.9E-15432487IPR005541KNOX2
PfamPF037917.9E-9438482IPR005541KNOX2
PROSITE profilePS512139.289553573IPR005539ELK domain
PROSITE profilePS5007111.467573636IPR001356Homeobox domain
SuperFamilySSF466891.63E-16575642IPR009057Homeodomain-like
SMARTSM003891.3E-8575640IPR001356Homeobox domain
CDDcd000861.14E-11576637No hitNo description
Gene3DG3DSA:1.10.10.603.6E-25580636IPR009057Homeodomain-like
PfamPF059202.0E-17593632IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 658 aa     Download sequence    Send to blast
MQMQMQAQLQ ASSSQLYWGS TSGFSQREVF DHHRVETHQP QSCFYDGDQG APKLVSGNAA  60
AAHSSIPNVN RECKKDPEED DFYERQIMAF GAPDYNGYNE GQQQLVPSWI GSAATIRQHM  120
MEMSGVPGDL EIRQQHMEHM EMSYSIPATG DTEGHASGSG IGKLPEDHPY SLHGAMTSEE  180
TKWCPVCAAN GSSQCLCGIP AYTMHAAAGD VASLSVPGSH EPSYTNYVHW LTIQSIMNMQ  240
RPDVNPAPPQ HPQDHGKQLA GATSLRDTIF ISASQTPPTR MVQMVQTETL QDQSATVHDD  300
QQAAAVMMSQ QQQQKFVQEL KEANHPHTPS QDDIVFGGQG TRNMAQGAAA ESAEEAAVRE  360
EVTAARKKAE EWEILRYKAM IVAHPLYLRL LAVHADCLRI GTPIDQLPGI DMQMERYMDV  420
TNKYAPVLMQ LDTIGAEEQA ELDDFMTQYI MLITAFKDHM QQHVYTDVAE AMMSCWELEQ  480
ILCNYTGEAC PLDNTGGATM SDSDSDNDII DDEYGYELPL PAMDQLDQRA GNTYSAMVSS  540
ETDRALMERV RQELKQELKE GYRAKIEEVR EEILRKRRAG KLPDGTTTVL KAWWNNHSKW  600
PYPTEEEKEG LIQETGLELK QVNNWFINQR KRNWHSNPLA ASSSADIMII SNLANVL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11060.12e-92KNOTTED1-like homeobox gene 4